Learn More
Invitrogen™ Human MFN1 (aa 525-588) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP106921
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66241 (PA5-66241. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Mitofusin 1 (MFN1) and the related protein MFN2 are mitochondrial membrane GTPase proteins that play a central role in mitochondrial metabolism and may be associated with obesity and/or apoptosis processes. MFN1 and MFN2 form homotypic and heterotypic complexes and coordinately regulate mitochondrial fusion and are essential for embryonic development. When ectopically expressed, MFN1 inhibits the apoptosis-associated amino-terminal conformation change in the apoptotic protein Bax but not its mitochondrial translocation, indicating that MFN1 is involved in the regulating the activation of Bax on the outer mitochondrial membrane.
Especificaciones
Q8IWA4 | |
Blocking Assay, Control | |
55669 | |
100 μL | |
2310002F04Rik; 6330416C07Rik; D3Ertd265e; DKFZp762F247; EC 3.6.5; FLJ20693; Fzo homolog; Fzo1b; hfzo1; hfzo2; HR2; Mfn1; MFN2; MGC41806; mitochondrial mitofusin 1; mitochondrial transmembrane GTPase Fzo-1; mitochondrial transmembrane GTPase FZO1B; mitochondrial transmembrane GTPase FZO-2; mitofusin 1; mitofusin 2; mitofusin-1; mKIAA4032; putative transmembrane GTPase; transmembrane GTPase MFN1 | |
MFN1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human MFN1 (aa 525-588) Control Fragment | |
RUO | |
MFN1 | |
Unconjugated | |
Recombinant | |
SLGWSSLVHRFLGPRNAQRVLLGLSEPIFQLPRSLASTPTAPTTPATPDNASQEELMITLVTGL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.