missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human METRN Partial ORF (NP_076947, 118 a.a. - 178 a.a.) Recombinant Protein with GST-tag at N-terminal
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Descripción
Meteorin regulates glial cell differentiation and promotes the formation of axonal networks during neurogenesis (Nishino et al., 2004 [PubMed 15085178]).[supplied by OMIM]
Sequence: CVRWGPRERRALFLQATPHQDISRRVAAFRFELREDGRPELPPQAHGLGVDGACRPCSDAE
Especificaciones
Especificaciones
Número de acceso | NP_076947 |
Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 79006 |
Peso molecular | 32.45kDa |
Nombre | METRN (Human) Recombinant Protein (Q01) |
Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Cantidad | 10 μg |
Inmunógeno | CVRWGPRERRALFLQATPHQDISRRVAAFRFELREDGRPELPPQAHGLGVDGACRPCSDAE |
Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Mostrar más |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ Human METRN Partial ORF (NP_076947, 118 a.a. - 178 a.a.) Recombinant Protein with GST-tag at N-terminal >
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido