missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human LRRC37A2 (aa 1614-1652) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP104444
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (38%), Rat (38%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-61874 (PA5-61874. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Especificaciones
| A6NM11 | |
| Blocking Assay, Control | |
| 474170 | |
| 100 μL | |
| c114 SLIT-like testicular protein; leucine rich repeat containing 37 member A2; leucine rich repeat containing 37, member A2; leucine-rich repeat containing 37 member A2; leucine-rich repeat-containing protein 37A2; LRRC37; LRRC37A2 | |
| LRRC37A2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human LRRC37A2 (aa 1614-1652) Control Fragment | |
| RUO | |
| LRRC37A2 | |
| Unconjugated | |
| Recombinant | |
| DEEGFSRGIFRFLPWRGCSSRRESQDGLSSFGQPLWFKD | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human LRRC37A2 (aa 1614-1652) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido