missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human LPCAT1 (aa 128-216) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP88773
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82460 (PA5-82460. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
PCAT1 acyltransferase (LPCAT; EC 2.3.1.23) catalyzes the conversion of LPC to hosphatidylcholine (PC) in the remodeling pathway of PC biosynthesis.
Especificaciones
| Q8NF37 | |
| Blocking Assay, Control | |
| 79888 | |
| 100 μL | |
| 1-acylglycerophosphocholine O-acyltransferase; 1-alkylglycerophosphocholine O-acetyltransferase; 2900035H07Rik; acetyl-CoA:lyso-PAF acetyltransferase; Acetyl-CoA:lyso-platelet-activating factor acetyltransferase; acyl-CoA:lysophosphatidylcholin; acyl-CoA:lysophosphatidylcholine acyltransferase 1; acyltransferase like 2; acyltransferase-like 2; AGPAT10; AGPAT9; Aytl2; BB137372; BC005662; C87117; LPC acyltransferase 1; LPCAT; LPCAT1; LPCAT-1; lyso-PAF acetyltransferase; lysoPAFAT; lysoPC acyltransferase 1; lysophosphatidylcholine acyltransferase 1; mLPCAT1; PFAAP3; Phosphonoformate immuno-associated protein 3; rd11; regulated by phosphonoformate; RGD1311599 | |
| LPCAT1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human LPCAT1 (aa 128-216) Control Fragment | |
| RUO | |
| LPCAT1 | |
| Unconjugated | |
| Recombinant | |
| AILTLAPHSSYFDAIPVTMTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTC | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human LPCAT1 (aa 128-216) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido