missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human LIPM (aa 33-68) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP109853
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (81%), Rat (81%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145001 (PA5-145001. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Plays a highly specific role in the last step of keratinocyte differentiation. May have an essential function in lipid metabolism of the most differentiated epidermal layers.
Especificaciones
| Q5VYY2 | |
| Blocking Assay, Control | |
| 340654 | |
| 100 μL | |
| bA304I5.1; lipase family member M; lipase M; lipase member M; lipase, family member M; lipase-like abhydrolase domain-containing protein 3; lipase-like, ab-hydrolase domain containing 3; LIPL3; LIPM | |
| LIPM | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human LIPM (aa 33-68) Control Fragment | |
| RUO | |
| LIPM | |
| Unconjugated | |
| Recombinant | |
| SVHMPTKAVDPEAFMNISEIIQHQGYPCEEYEVATE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human LIPM (aa 33-68) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
