Learn More
Abnova™ Human LILRA2 Full-length ORF (AAH27916.1, 1 a.a. - 466 a.a.) Recombinant Protein with GST-tag at N-terminal
Descripción
Leukocyte Ig-like receptors (LIRs) are a family of immunoreceptors expressed predominantly on monocytes and B cells and at lower levels on dendritic cells and natural killer (NK) cells. All LIRs in subfamily B have an inhibitory function (see, e.g., LILRB1, MIM 604811). LIRs in subfamily A, with short cytoplasmic domains lacking an immunoreceptor tyrosine-based inhibitory motif (ITIM) and with transmembrane regions containing a charged arginine residue, may initiate stimulatory cascades. One member of subfamily A (LILRA3; MIM 604818) lacks a transmembrane region and is presumed to be a soluble receptor.[supplied by OMIM]
Especificaciones
Especificaciones
Número de acceso | AAH27916.1 |
Para utilizar con (aplicación) | Antibody Production, Protein Array, ELISA, Western Blot |
Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
ID de gen (Entrez) | 11027 |
Peso molecular | 77kDa |
Nombre | LILRA2 (Human) Recombinant Protein (P01) |
Método de purificación | Glutathione Sepharose 4 Fast Flow |
Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue |
Cantidad | 10 μg |
Inmunógeno | MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSIAREHAGRYHCQYYSHNHSSEYSDPLELVVTGAYGKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVLYKEGERDFLQRPGWQPQAGLSQANFTLGPVSPSHGGQYRCYSAHNLSSEWSAPSDPLDILITGQFYDRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMGPVTSAHVGTYRCYSSLSSNPYLLSLPSDPLELVVSASLGQHPQDYTVENLIRMGVAGLVLVVLGILLFEAQHSQRSLQDAAGR |
Mostrar más |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.