Learn More
Invitrogen™ Human LETM1 (aa 40-127) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP90426
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52789 (PA5-52789. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a protein that is localized to the inner mitochondrial membrane. The protein functions to maintain the mitochondrial tubular shapes and is required for normal mitochondrial morphology and cellular viability. Mutations in this gene cause Wolf-Hirschhorn syndrome, a complex malformation syndrome caused by the deletion of parts of the distal short arm of chromosome 4. Related pseudogenes have been identified on chromosomes 8, 15 and 19.
Especificaciones
O95202 | |
Blocking Assay, Control | |
3954 | |
100 μL | |
LETM1; LETM1 and EF-hand domain-containing protein 1, mitochondrial; leucine zipper and EF-hand containing transmembrane protein 1; leucine zipper-EF-hand containing transmembrane protein 1; leucine zipper-EF-hand-containing transmembrane protein 1; Mdm38 homolog; Mitochondrial proton/calcium exchanger protein | |
LETM1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human LETM1 (aa 40-127) Control Fragment | |
RUO | |
LETM1 | |
Unconjugated | |
Recombinant | |
STLGLRNCLNVPFGCCTPIHPVYTSSRGDHLGCWALRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRDDSVVEKSLKSL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.