missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human LETM1 (aa 40-127) Control Fragment Recombinant Protein Código de producto.: 30194352
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30194352

Invitrogen™ Human LETM1 (aa 40-127) Control Fragment Recombinant Protein

Código de producto. 30194352
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30194352

Marca: Invitrogen™ RP90426

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (56%), Rat (56%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52789 (PA5-52789. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a protein that is localized to the inner mitochondrial membrane. The protein functions to maintain the mitochondrial tubular shapes and is required for normal mitochondrial morphology and cellular viability. Mutations in this gene cause Wolf-Hirschhorn syndrome, a complex malformation syndrome caused by the deletion of parts of the distal short arm of chromosome 4. Related pseudogenes have been identified on chromosomes 8, 15 and 19.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso O95202
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3954
Nombre Human LETM1 (aa 40-127) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen LETM1; LETM1 and EF-hand domain-containing protein 1, mitochondrial; leucine zipper and EF-hand containing transmembrane protein 1; leucine zipper-EF-hand containing transmembrane protein 1; leucine zipper-EF-hand-containing transmembrane protein 1; Mdm38 homolog; Mitochondrial proton/calcium exchanger protein
Nombre común LETM1
Símbolo de gen LETM1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia STLGLRNCLNVPFGCCTPIHPVYTSSRGDHLGCWALRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRDDSVVEKSLKSL
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Invitrogen™ Human LETM1 (aa 40-127) Control Fragment Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.