missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human Latexin (aa 1-106) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP89833
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82498 (PA5-82498. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes the only known protein inhibitor of zinc-dependent metallocarboxypeptidases.
Especificaciones
| Q9BS40 | |
| Blocking Assay, Control | |
| 56925 | |
| 100 μL | |
| ECI; endogenous carboxypeptidase inhibitor; Latexin; latexin protein; Lxn; MUM; Protein MUM; TCI; tissue carboxypeptidase inhibitor | |
| LXN | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human Latexin (aa 1-106) Control Fragment | |
| RUO | |
| Latexin | |
| Unconjugated | |
| Recombinant | |
| MEIPPTNYPASRAALVAQNYINYQQGTPHRVFEVQKVKQASMEDIPGRGHKYHLKFAVEEIIQKQVKVNCTAEVLYPSTGQETAPEVNFTFEGETGKNPDEEDNTF | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human Latexin (aa 1-106) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido