missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human LAMP5 (aa 66-191) Control Fragment Recombinant Protein Código de producto.: 30198879
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30198879

Invitrogen™ Human LAMP5 (aa 66-191) Control Fragment Recombinant Protein

Código de producto. 30198879
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30198879

Marca: Invitrogen™

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52112 (PA5-52112. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Lysosome-associated membrane protein 5 (LAMP5) is a member of the LAMP family. LAMP5 differs from other LAMP family members in that its expression is more restricted and is referred to as brain and dendritic cell-associated LAMP-like molecule (BAD-LAMP). In humans, BAD-LAMP is expressed in post-natal neurons and non-activated plasmacytoid dendritic cells. Expression in neurons is localized to intracellular vesicles distributed in specific microdomains along neurites and may play a role in endocytosis. BAD-LAMP is localized to the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) of plasmacytoid dendritic cells and is lost upon TLR activation.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9UJQ1
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 24141
Nombre Human LAMP5 (aa 66-191) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 3110035N03Rik; 6330527O06Rik; BADLAMP; BAD-LAMP; brain and dendritic cell associated LAMP; brain and dendritic cell-associated LAMP; Brain-associated LAMP-like protein; C20orf103; LAMP family protein C20orf103; LAMP family protein C20orf103 homolog; LAMP5; LAMP-5; lysosomal associated membrane protein family member 5; lysosomal-associated membrane protein family, member 5; lysosome-associated membrane glycoprotein 5; Lysosome-associated membrane protein 5; Protein C20orf103; RGD1306991; UNC-46
Nombre común LAMP5 (BAD-LAMP)
Símbolo de gen LAMP5
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia FIVPYDVWASNYVDLITEQADIALTRGAEVKGRCGHSQSELQVFWVDRAYALKMLFVKESHNMSKGPEATWRLSKVQFVYDSSEKTHFKDAVSAGKHTANSHHLSALVTPAGKSYECQAQQTISLA
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human LAMP5 (aa 66-191) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado