missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human KMT2C (aa 3295-3376) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP108014
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-67359 (PA5-67359. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Histone methyltransferase. Methylates 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Central component of the MLL2/3 complex, a coactivator complex of nuclear receptors, involved in transcriptional coactivation. KMT2C/MLL3 may be a catalytic subunit of this complex. May be involved in leukemogenesis and developmental disorder.
Especificaciones
| Q8NEZ4 | |
| Blocking Assay, Control | |
| 58508 | |
| 100 μL | |
| 2.1.1.43; ALR-like protein; HALR; Histone-lysine N-methyltransferase 2 C; histone-lysine N-methyltransferase MLL3; histone-lysine N-methyltransferase, H3 lysine-4 specific; homologous to ALR protein; KIAA1506; KMT2C; lysine (K)-specific methyltransferase 2 C; lysine methyltransferase 2 C; Lysine N-methyltransferase 2 C; MLL3; Myeloid/lymphoid or mixed-lineage leukemia protein 3 | |
| KMT2C | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human KMT2C (aa 3295-3376) Control Fragment | |
| RUO | |
| KMT2C | |
| Unconjugated | |
| Recombinant | |
| TPPTMSQPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQ | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human KMT2C (aa 3295-3376) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido