missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human JARID2 (aa 967-1050) Control Fragment Recombinant Protein Código de producto.: 30203236
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30203236

Invitrogen™ Human JARID2 (aa 967-1050) Control Fragment Recombinant Protein

Código de producto. 30203236
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30203236

Marca: Invitrogen™ RP107294

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (96%), Rat (96%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Jumonji (JARID2) is a nuclear protein that participates in the negative regulation of cell growth. It is required for neural tube formation and is essential for normal heart development and function. Also, it is a part of a group of proteins characterized by a novel structural motif, the JmjC domain, which is implicated in chromatin regulation through histone demethylation.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q92833
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3720
Nombre Human JARID2 (aa 967-1050) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen JARD2 antibody; Jarid2; Jmj; jumonji; jumonji and AT-rich interaction domain containing 2; jumonji homolog; jumonji, AT rich interactive domain 2; jumonji, AT rich interactive domain 2 protein; jumonji/ARID domain-containing protein 2; jumonji-like protein; LOW QUALITY PROTEIN: protein Jumonji; protein Jumonji
Nombre común JARID2
Símbolo de gen JARID2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LLQANGTPGLQMLESNVMISPEVLCKEGIKVHRTVQQSGQFVVCFPGSFVSKVCCGYSVSETVHFATTQWTSMGFETAKEMKRR
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human JARID2 (aa 967-1050) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado