Learn More
Invitrogen™ Human ITK (aa 159-241) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP108844
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ITK is a tyrosine kinase expressed in T-cells which contains both SH2 and SH3 domains. ITK is thought to play a role in T-cell proliferation and differentiation. The Tec family of non-receptor tyrosine kinases is composed of six proteins designated Tec, Itk (also known as Emt or Tsk), Btk (previously known as Atk, BPK or Emb), Bmx, Txk (also known as Rlk) and Dsrc28C. All members of the family contain SH3 and SH2 domains and, with the exception of Txk and Dsrc28C, also contain pleckstrin homology (PH) and Tec homology (TH) domains in their amino termini. Itk associates with CD28 and becomes activated subsequent to CD28 ligation.
Especificaciones
Q08881 | |
Blocking Assay, Control | |
3702 | |
100 μL | |
EMT; homolog of mouse T-cell itk/tsk; IL2 inducible T cell kinase; IL2 inducible T-cell kinase; IL-2-inducible T cell kinase; IL-2-inducible T-cell kinase; IL2-inducible T-cell kinase; interleukin-2-inducible T cell kinase; interleukin-2-inducible T-cell kinase; ITK; Kinase EMT; kinase TLK; LPFS1; LYK; MGC126257; MGC126258; PSCTK2; T-cell-specific kinase; Tcsk; Tlk; Tsk; Tyrosine-protein kinase ITK/TSK; tyrosine-protein kinase LYK | |
ITK | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ITK (aa 159-241) Control Fragment | |
RUO | |
ITK | |
Unconjugated | |
Recombinant | |
PTPEDNRRPLWEPEETVVIALYDYQTNDPQELALRRNEEYCLLDSSEIHWWRVQDRNGHEGYVPSSYLVEKSPNNLETYEWYN | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.