missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human INMT (aa 137-187) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP107054
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (67%), Rat (67%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66379 (PA5-66379. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
N-methylation of endogenous and xenobiotic compounds is a major method by which they are degraded. This gene encodes an enzyme that N-methylates indoles such as tryptamine.
Especificaciones
| O95050 | |
| Blocking Assay, Control | |
| 11185 | |
| 100 μL | |
| Amine N-methyltransferase; aromatic alkylamine N-methyltransferase; arylamine N-methyltransferase; indolamine N-methyltransferase; Indolethylamine N-methyltransferase; Inmt; nicotine N-methyltransferase; Temt; Thioether S-methyltransferase | |
| INMT | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human INMT (aa 137-187) Control Fragment | |
| RUO | |
| INMT | |
| Unconjugated | |
| Recombinant | |
| RVLKCDVHLGNPLAPAVLPLADCVLTLLAMECACCSLDAYRAALCNLASLL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human INMT (aa 137-187) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido