missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human IMP4 (aa 111-194) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP107487
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66830 (PA5-66830. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
IMP4 forms a ternary complex with IMP3.
Especificaciones
| Q96G21 | |
| Blocking Assay, Control | |
| 92856 | |
| 100 μL | |
| AA409888; AV031295; Brix domain-containing protein 4; BXDC4; D1Wsu40e; IMP4; IMP4 homolog, U3 small nucleolar ribonucleoprotein; IMP4, U3 small nucleolar ribonucleoprotein; IMP4, U3 small nucleolar ribonucleoprotein, homolog; IMP4, U3 small nucleolar ribonucleoprotein, homolog (yeast); LRRGT00017; RGD1308463; U3 small nucleolar ribonucleoprotein protein IMP4; U3 snoRNP protein 4 homolog; U3 snoRNP protein IMP4 | |
| Imp4 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human IMP4 (aa 111-194) Control Fragment | |
| RUO | |
| IMP4 | |
| Unconjugated | |
| Recombinant | |
| AQRMNRGRHEVGALVRACKANGVTDLLVVHEHRGTPVGLIVSHLPFGPTAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFSSR | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human IMP4 (aa 111-194) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido