missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human IL3RA Partial ORF (NP_002174, 19 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal Código de producto.: 16196761

Abnova™ Human IL3RA Partial ORF (NP_002174, 19 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal

Código de producto. 16196761
10 ug, 10 microgramos
Click to view available options
Cantidad:
10 ug
25 ug
Tamaño de la unidad:
10 microgramos
25 microgramos
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16196761

Marca: Abnova™ H00003563Q01.10ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. [provided by RefSeq]

Sequence: TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAEN

Especificaciones

Número de acceso NP_002174
Para utilizar con (aplicación) Antibody Production, ELISA, Protein Array, Western Blot
Formulación 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID de gen (Entrez) 3563
Peso molecular 35.75kDa
Nombre IL3RA (Human) Recombinant Protein (Q01)
Pruebas de control de calidad 12.5% SDS-PAGE Stained with Coomassie Blue.
Cantidad 10 ug
Inmunógeno TKEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAEN
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Estado normativo RUO
Alias de gen CD123/IL3R/IL3RAY/IL3RX/IL3RY/MGC34174/hIL-3Ra
Nombre común IL3RA
Símbolo de gen IL3RA
Especie Wheat Germ (in vitro)
Recombinante Recombinant
Etiqueta de proteína GST
Sistema de expresión wheat germ expression system
Formulario Liquid
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Abnova™ Human IL3RA Partial ORF (NP_002174, 19 a.a. - 109 a.a.) Recombinant Protein with GST-tag at N-terminal >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado