missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human IkB zeta (aa 454-586) Control Fragment Recombinant Protein Código de producto.: 30210005
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30210005

Invitrogen™ Human IkB zeta (aa 454-586) Control Fragment Recombinant Protein

Código de producto. 30210005
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30210005

Marca: Invitrogen™ RP89844

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52703 (PA5-52703. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

I-kappa-B-zeta (also known as MAIL and INAP) is an ankyrin-repeat-containing nuclear protein that is highly homologous to the IkappaB family member Bcl-3. Transcription of IkappaBzeta is upregulated by stimulation with TLR ligands, IL-1 and IL-6 in cultured B-lymphocytes and monocytes/macrophages, but only faintly so in T-lymphocytes, fibroblasts, and endothelial cells. IkappaB-zeta preferentially associates with the NF-kappaB subunit p50 rather than p65 and recombinant IkappaB-zeta proteins inhibit the DNA binding of the p65/p50 heterodimer and the p50/p50 homodimer.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9BYH8
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 64332
Nombre Human IkB zeta (aa 454-586) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen AA408868; FLJ30225; FLJ34463; Ikappa B-zeta variant 3; ikappaBzeta; I-kappa-B-zeta; IkappaB-zeta; IKBZ; ikB-zeta; IL-1 inducible nuclear ankyrin-repeat protein; INAP; Mail; molecule possessing ankyrin repeats induced by lipopolysaccharide; molecule possessing ankyrin-repeats induced by lipopolysaccharide; NF-kappa-B inhibitor zeta; NFKB inhibitor zeta; NFKBIZ; nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, zeta; nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, zeta; OTTHUMP00000214340; RGD1310834
Nombre común IkB zeta
Símbolo de gen NFKBIZ
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia QGRRALSYVLARKMNALHMLDIKEHNGQSAFQVAVAANQHLIVQDLVNIGAQVNTTDCWGRTPLHVCAEKGHSQVLQAIQKGAVGSNQFVDLEATNYDGLTPLHCAVIAHNAVVHELQRNQQPHSPEVQELLL
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human IkB zeta (aa 454-586) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado