Learn More
Invitrogen™ Human IGFBP7 (aa 157-257) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP101046
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-51693 (PA5-51693. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the insulin-like growth factor (IGF)-binding protein (IGFBP) family. IGFBPs bind IGFs with high affinity, and regulate IGF availability in body fluids and tissues and modulate IGF binding to its receptors. This protein binds IGF-I and IGF-II with relatively low affinity, and belongs to a subfamily of low-affinity IGFBPs. It also stimulates prostacyclin production and cell adhesion. Alternatively spliced transcript variants encoding different isoforms have been described for this gene, and one variant has been associated with retinal arterial macroaneurysm.
Especificaciones
Q16270 | |
Blocking Assay, Control | |
3490 | |
100 μL | |
AGM; angiomodulin; FSTL2; IBP7; IBP-7; IGF-binding protein 7; IGFBP; IGFBP rP1; Igfbp7; IGFBP-7; IGFBP-7 V; IGFBPRP1; IGFBP-rP1; Insulin like growth factor binding protein; insulin like growth factor binding protein 7; insulin-like growth factor binding protein 7; insulin-like growth factor-binding protein 7; Mac25; MAC25 protein; PGI2-stimulating factor; prostacyclin-stimulating factor; PSF; RAMSVPS; TAF; Tumor-derived adhesion factor | |
IGFBP7 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
3.90 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human IGFBP7 (aa 157-257) Control Fragment | |
RUO | |
IGFBP7 | |
Unconjugated | |
Recombinant | |
EQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQA | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.