missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human IDO (aa 207-303) Control Fragment Recombinant Protein Código de producto.: 30212925

Invitrogen™ Human IDO (aa 207-303) Control Fragment Recombinant Protein

Código de producto. 30212925
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30212925

Marca: Invitrogen™ RP93786

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (62%), Rat (62%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

IDO1 is an intracellular heme-containing enzyme that catalyzes the oxidative cleavage of the indole ring of several important regulatory molecules like tryptophan, serotonin, and melatonin. By doing this, IDO1 initiates the production of biologically active metabolites, commonly referred to as kynurenines. IDO1 is widely expressed in a variety of human tissues as well as in macrophages and dendritic cells (DCs). In inflammation, interferons (IFNs) act on specific receptors to trigger IDO1 induction. The production of IFN-gamma and induction of IDO1 represent important antimicrobial mechanisms. Degradation and depletion of tryptophan by IDO1 inhibits the growth of viruses, bacteria and parasites. Furthermore, IDO1 plays a complex and crucial role in immunoregulation during infection, pregnancy, autoimmunity, transplantation, and neoplasia.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P14902
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3620
Nombre Human IDO (aa 207-303) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen EC 1.13.11.52; IDO; IDO1; IDO-1; INDO; indolamine 2,3 dioxygenase; indole 2,3-dioxygenase; indoleamine; indoleamine 2,3-dioxygenase 1; indoleamine 23-dioxygenase; Indoleamine-2; indoleamine-pyrrole 2,3 dioxygenase; indoleamine-pyrrole 2,3-dioxygenase
Nombre común IDO
Símbolo de gen Ido1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia LEKALQVFHQIHDHVNPKAFFSVLRIYLSGWKGNPQLSDGLVYEGFWEDPKEFAGGSAGQSSVFQCFDVLLGIQQTAGGGHAAQFLQDMRRYMPPAH
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human IDO (aa 207-303) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado