Learn More
Invitrogen™ Human ID2 (aa 62-134) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP95279
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The inhibitor of DNA binding 2 (ID2) protein is essential for promoting the development of a number of cell types including natural killer cell, erythroid precursors, as well as, CD8+ and CD4+ T-cell. A lack of ID2 promotes B-cell development. The chief role of this protein is to associate with ubiquitously-expressed E proteins, and other proteins of the basic helix-loop-helix (HLH) family, preventing them from binding to DNA and activating transcription. Activation of ID2 is critical for the development of the natural killer cell lineage.
Especificaciones
Q02363 | |
Blocking Assay, Control | |
3398 | |
100 μL | |
Ac2-300; AI255428; bHLHb26; C78922; cell growth-inhibiting gene 8; class B basic helix-loop-helix protein 26; DNA-binding protein inhibitor ID2; DNA-binding protein inhibitor ID-2; GIG8; helix-loop-helix protein ID2; Id2; Id-2; ID2A; ID2H; Idb2; Inhibitor of differentiation 2; inhibitor of DNA binding 2; inhibitor of DNA binding 2, dominant negative helix-loop-helix protein; inhibitor of DNA binding 2, HLH protein; MGC26389; OTTHUMP00000140258; OTTHUMP00000200297 | |
ID2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ID2 (aa 62-134) Control Fragment | |
RUO | |
ID2 | |
Unconjugated | |
Recombinant | |
MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.