Learn More
Invitrogen™ Human ICT1 (aa 158-206) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP110113
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145150 (PA5-145150. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Essential peptidyl-tRNA hydrolase component of the mitochondrial large ribosomal subunit. Acts as a codon-independent translation release factor that has lost all stop codon specificity and directs the termination of translation in mitochondrion, possibly in case of abortive elongation. May be involved in the hydrolysis of peptidyl-tRNAs that have been prematurely terminated and thus in the recycling of stalled mitochondrial ribosomes.
Especificaciones
Q14197 | |
Blocking Assay, Control | |
3396 | |
100 μL | |
1110001A02Rik; 1110002E03Rik; 39 S ribosomal protein L58, mitochondrial; Digestion substraction 1; DS1; DS-1; Ict1; immature colon carcinoma transcript 1; immature colon carcinoma transcript 1 protein; Immature colon carcinoma transcript 1 protein homolog; Mitochondrial large ribosomal subunit protein mL62; mitochondrial ribosomal protein L58; MRPL58; MRP-L58; Peptidyl-tRNA hydrolase ICT1, mitochondrial | |
MRPL58 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ICT1 (aa 158-206) Control Fragment | |
RUO | |
ICT1 | |
Unconjugated | |
Recombinant | |
ITEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSRRVDMD | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.