missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human ICEBERG (aa 48-90) Control Fragment Recombinant Protein Código de producto.: 30211515

Invitrogen™ Human ICEBERG (aa 48-90) Control Fragment Recombinant Protein

Código de producto. 30211515
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30211515

Marca: Invitrogen™ RP97330

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (47%), Rat (47%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58451 (PA5-58451. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Inhibits generation of IL-1-beta by interacting with caspase-1 and preventing its association with RIP2. Down-regulates the release of IL1B.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P57730
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 59082
Nombre Human ICEBERG (aa 48-90) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen CARD18; caspase recruitment domain family member 18; caspase recruitment domain family, member 18; caspase recruitment domain-containing protein 18; Caspase-1 inhibitor Iceberg; ICEBERG; ICEBERG caspase-1 inhibitor; pseudo-ICE; UNQ5804; UNQ5804/PRO19611
Nombre común ICEBERG
Símbolo de gen CARD18
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia DTVMDKARVLIDLVTGKGPKSCCKFIKHLCEEDPQLASKMGLH
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human ICEBERG (aa 48-90) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado