missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human HuD (aa 2-45) Control Fragment Recombinant Protein Código de producto.: 30202206
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30202206

Invitrogen™ Human HuD (aa 2-45) Control Fragment Recombinant Protein

Código de producto. 30202206
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30202206

Marca: Invitrogen™ RP108358

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83642 (PA5-83642. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HuD, otherwise known as ELAV-like protein 4 or PNEM, is a protein that in humans is encoded by the ELAVL4 gene. This human gene is located at 1p34 by in situ hybridization. The HuD/ELAVL4 protein is an RNA-binding protein. ELAVL4 has specificity for 3-prime uridylate-rich untranslated regions of growth factor mRNAs. HuD is expressed only in neurons and it binds to AU-rich element-containing mRNAs. As a result of this interaction the, half-life of the transcript is increased. Additionally, HuD is important in neurons during brain development and plasticity.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso P26378
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 1996
Nombre Human HuD (aa 2-45) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Elav; ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D); ELAV like neuron-specific RNA binding protein 4; ELAVL4; ELAV-like protein 4; Hu antigen D; HU-antigen D; Hud; Paraneoplastic encephalomyelitis antigen HuD; PNEM; RGD1561943; r-HuD; RNA-binding protein HUD3
Nombre común HuD
Símbolo de gen ELAVL4
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia VMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human HuD (aa 2-45) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado