Learn More
Invitrogen™ Human HRD1 (aa 450-589) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP89210
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (92%), Rat (92%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82191 (PA5-82191. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
HRD1 is a ubiquitin ligase whose expression is induced by the unfolded protein response (UPR) following endoplasmic reticulum stress. Expression of HRD1 protects cells from apoptosis by inducing degradation of abnormally processed proteins that accumulate in the endoplasmic reticulum. HRD1 is expressed in many tissues, strongly expressed in brain, pancreas, liver, kidney and skeletal muscle. It has been reported that Synoviolin/Hrd1 (expressed in rheumatoid synovium) is a novel causative factor for arthropathy by triggering synovial cell outgrowth through its anti-apoptotic effects. HRD1 contains one ring-type zinc finger.
Especificaciones
Q86TM6 | |
Blocking Assay, Control | |
84447 | |
100 μL | |
1200010C09Rik; AW211966; C85322; D530017H19Rik; DER3; E3 ubiquitin-protein ligase synoviolin; HMG-coA reductase degradation 1 homolog; Hrd1; HRD1 protein; KIAA1810; MGC40372; RGD1310488; RING-type E3 ubiquitin transferase synoviolin; Synovial apoptosis inhibitor 1; synovial apoptosis inhibitor 1, synoviolin; synoviolin 1; Syvn1 | |
SYVN1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human HRD1 (aa 450-589) Control Fragment | |
RUO | |
HRD1 | |
Unconjugated | |
Recombinant | |
PAPGFPFPPPWMGMPLPPPFAFPPMPVPPAGFAGLTPEELRALEGHERQHLEARLQSLRNIHTLLDAAMLQINQYLTVLASLGPPRPATSVNSTEETATTVVAAASSTSIPSSEATTPTPGASPPAPEMERPPAPESVGT | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.