missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human HLA-DRA (aa 25-64) Control Fragment Recombinant Protein Código de producto.: 30206006

Invitrogen™ Human HLA-DRA (aa 25-64) Control Fragment Recombinant Protein

Code produit. 30206006
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Conditionnement:
100 microlitros
Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Código de producto. 30206006

Marca: Invitrogen™ RP103147

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Les retours ne sont pas autorisés pour ce produit. Afficher la politique du retour.

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (41%), Rat (41%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111368 (PA5-111368. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HLA-DRA is one of the HLA class II alpha chain paralogues. This class II molecule is a heterodimer consisting of an alpha and a beta chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa and its gene contains 5 exons. Exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. DRA does not have polymorphisms in the peptide binding part and acts as the sole alpha chain for DRB1, DRB3, DRB4 and DRB5. HLA and MHC antibodies play a significant role in Immunopeptidomics, facilitating the identification and characterization of neoantigens through high-performance liquid chromatography coupled to tandem Mass Spectrometry.
TRUSTED_SUSTAINABILITY

Spécification

Número de acceso P01903
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 3122
Nombre Human HLA-DRA (aa 25-64) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen histocompatibility antigen HLA-DR alpha; HLA class II histocompatibility antigen, DR alpha chain; HLA-DRA; HLA-DRA1; major histocompatibility complex, class II, DR alpha; MHC cell surface glycoprotein; MHC class II antigen DRA; MLRW
Nombre común HLA-DRA
Símbolo de gen HLA-DRA
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia AIKEEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKK
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Afficher plus Afficher moins
Correction du contenu d'un produit

Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.

Nom du produit
Invitrogen™ Human HLA-DRA (aa 25-64) Control Fragment Recombinant Protein >

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis