missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human HEF1 (aa 245-330) Control Fragment Recombinant Protein Código de producto.: 30205295

Invitrogen™ Human HEF1 (aa 245-330) Control Fragment Recombinant Protein

Código de producto. 30205295
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30205295

Marca: Invitrogen™ RP104700

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83453 (PA5-83453. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

HEF-1 is a multifunctional protein involved in integrin-based signaling that affects cell motility, growth, apoptosis and oncogenic transformation. The Cas family of docking proteins have been the subject of intense research because of their role in cell motility, growth, apoptosis and oncogenic transformation. These proteins are substrates of focal adhesion kinase (FAK) and the Src family of tyrosine kinases two active targets for drug development. HEF1 protein production increases levels of mRNA transcripts that encode proteins associated with motility, cell transformation and invasiveness, including several metalloproteinases, MLCK, p160ROCK and ErbBi. HEF1 overproduction also mediates apoptosis in epithelial-derived cell lines, including MCF7 and HeLa cells. Recent clinical studies at another institution have found that overexpression of BCAR1 (p130Cas), a related protein, is associated with tamoxifen resistance. This highlights the importance of studying the role of this family of proteins in cancer prognosis.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q14511
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 4739
Nombre Human HEF1 (aa 245-330) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen Cas scaffolding protein family member 2; CAS2; CASL; CAS-L; cas-like docking; CASS2; Crk-associated substrate lymphocyte-specific protein; Crk-associated substrate related protein Cas-L; CRK-associated substrate-related protein; dJ49G10.2; dJ761I2.1; Enhancer of filamentation 1; Enhancer of filamentation 1 p55; HEF1; mEF1; Nedd9; NEDD-9; Neural precursor cell expressed developmentally down-regulated protein 9; neural precursor cell expressed, developmentally down-regulated 9; neural precursor cell expressed, developmentally down-regulated gene 9; p105; p130Cas-related protein; renal carcinoma antigen NY-REN-12
Nombre común HEF1
Símbolo de gen NEDD9
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PPMRQAGRPDLRPEGVYDIPPTCTKPAGKDLHVKYNCDIPGAAEPVARRHQSLSPNHPPPQLGQSVGSQNDAYDVPRGVQFLEPPA
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human HEF1 (aa 245-330) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado