Learn More
Invitrogen™ Human GPR98 (aa 2669-2812) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP107583
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-84761 (PA5-84761. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the G-protein coupled receptor superfamily. The encoded protein contains a 7-transmembrane receptor domain, binds calcium and is expressed in the central nervous system. Mutations in this gene are associated with Usher syndrome 2 and familial febrile seizures. Several alternatively spliced transcripts have been described.
Especificaciones
Q8WXG9 | |
Blocking Assay, Control | |
84059 | |
100 μL | |
4-Feb; ADGRV1; ADGRV1 subunit alpha; ADGRV1 subunit beta; adhesion G protein-coupled receptor V1; Adhesion G-protein coupled receptor V1; FEB4; Frings; G protein-coupled receptor 98; Gpr98; G-protein coupled receptor 98; KIAA0686; KIAA1943; MASS1; Mgr1; monogenic; monogenic audiogenic seizure susceptibility protein 1; monogenic audiogenic seizure susceptibility protein 1 homolog; monogenic, audiogenic seizure susceptibility 1; monogenic, audiogenic seizure susceptibility 1 homolog; neurepin; USH2B; USH2C; Usher syndrome type-2 C protein; very large G protein-coupled receptor 1; very large G-protein coupled receptor 1; VLGR1; VLGR1b | |
ADGRV1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human GPR98 (aa 2669-2812) Control Fragment | |
RUO | |
GPR98 | |
Unconjugated | |
Recombinant | |
ESIIVSLVYTEGGSRILPSSDTVRVNILANDNVAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFFPEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAA | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.