missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GPATCH4 (aa 10-97) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP104995
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65858 (PA5-65858. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The function of this protein remains unknown.
Especificaciones
| Q5T3I0 | |
| Blocking Assay, Control | |
| 54865 | |
| 100 μL | |
| 2610029K21Rik; DKFZP434F1735; FLJ20249; G patch domain containing 4; G patch domain-containing protein 4; Gpatc4; G-patch domain containing 4; Gpatch4; RGD1311086 | |
| GPATCH4 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GPATCH4 (aa 10-97) Control Fragment | |
| RUO | |
| GPATCH4 | |
| Unconjugated | |
| Recombinant | |
| RGMKFAEEQLLKHGWTQGKGLGRKENGITQALRVTLKQDTHGVGHDPAKEFTNHWWNELFNKTAANLVVETGQDGVQIRSLSKETTRY | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human GPATCH4 (aa 10-97) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido