Learn More
Invitrogen™ Human GMEB1 (aa 365-454) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP100591
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60837 (PA5-60837. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene is a member of KDWK gene family. The product of this gene associates with GMEB2 protein, and the complex is essential for parvovirus DNA replication. Study of rat homolog implicates the role of this gene in modulation of transactivation by the glucocorticoid receptor bound to glucocorticoid response elements. Two alternative spliced transcript variants encoding different isoforms exist.
Especificaciones
Q9Y692 | |
Blocking Assay, Control | |
10691 | |
100 μL | |
1110050A04Rik; AI256615; AI481278; DNA-binding protein p96PIF; glucocorticoid modulatory element binding protein 1; glucocorticoid modulatory element-binding protein 1; Gmeb1; GMEB-1; P96PIF; Parvovirus initiation factor p96; PIF p96; PIF96; RGD1563208 | |
GMEB1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human GMEB1 (aa 365-454) Control Fragment | |
RUO | |
GMEB1 | |
Unconjugated | |
Recombinant | |
NVVLMPVSTPKPPKRPRLQRPASTTVLSPSPPVQQPQFTVISPITITPVGQSFSMGNIPVATLSQGSSPVTVHTLPSGPQLFRYATVVSS | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.