missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human GLG1 (aa 997-1146) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP90019
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82407 (PA5-82407. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
GLG1 is a protein coding gene. Binds fibroblast growth factor and E-selectin (cell-adhesion lectin on endothelial cells mediating the binding of neutrophils).
Especificaciones
| Q92896 | |
| Blocking Assay, Control | |
| 2734 | |
| 100 μL | |
| AI593353; AW537898; CFR; CFR1; CFR-1; Cysteine-rich fibroblast growth factor receptor; E-selectin ligand 1; ESL1; ESL-1; Glg1; Golgi apparatus protein 1; golgi glycoprotein 1; golgi sialoglycoprotein MG-160; MG160; MG-160; selectin, endothelial cell, ligand; Selel | |
| GLG1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human GLG1 (aa 997-1146) Control Fragment | |
| RUO | |
| GLG1 | |
| Unconjugated | |
| Recombinant | |
| LDYRLDPQLQLHCSDEISSLCAEEAAAQEQTGQVEECLKVNLLKIKTELCKKEVLNMLKESKADIFVDPVLHTACALDIKHHCAAITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAMQVMTSPSKNY | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human GLG1 (aa 997-1146) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido