missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human GCP2 (aa 742-833) Control Fragment Recombinant Protein

Recombinant Protein

Marca:  Invitrogen™ RP97084

Código de producto. 30203258

  • 265.00€ / 100 microlitros

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Explore más ofertas especiales
Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Descripción

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58151 (PA5-58151. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The γ-Tubulin complex is composed of γ Tubulin and the γ-Tubulin complexassociated proteins GCP2, GCP3, GCP4, GCP5 and GCP6, all of which are essential components of microtubule organizing centers. γ-Tubulin complex components are localized to both the centrosome, where they are involved in microtubule nucleation, and to the cytoplasm, where they exist as soluble complexes that can be recruited to the centrosome as needed. Although the GCP proteins are related, they have distinct roles which contribute to the proper function of the γ-Tubulin complex. GCP2 (γ-Tubulin complex component 2), also known as TUBGCP2 or SPBC97 (spindle pole body protein Spc97 homolog) is a ubiquitously expressed 902 amino acid protein that localizes to the centrosome and is involved in microtubule nucleation.
TRUSTED_SUSTAINABILITY
Especificaciones

Especificaciones

Q9BSJ2
Blocking Assay, Control
10844
100 μL
1700022B05Rik; a disintegrin and metalloprotease domain 8; Adam8; Gamma-ring complex protein 103 kDa; gamma-tubulin complex component 2; GCP2; GCP-2; Grip103; h103p; hGCP2; hGrip103; hSpc97; SPBC97; Spc97p; spindle pole body protein Spc97 homolog; Tubgcp2; tubulin gamma complex associated protein 2; tubulin, gamma complex associated protein 2
TUBGCP2
Human
His-ABP-tag
-20°C, Avoid Freeze/Thaw Cycles
Liquid
≥5.0 mg/mL
1 M urea, PBS with no preservative; pH 7.4
Human GCP2 (aa 742-833) Control Fragment
RUO
GCP2
Unconjugated
Recombinant
PELLKVFSKLMSVCVMFTNCMQKFTQSMKLDGELGGQTLEHSTVLGLPAGAEERARKELARKHLAEHADTVQLVSGFEATINKFDKNFSAHL
E. coli
>80% by SDS-PAGE and Coomassie blue staining
Sugerencias de productos

Sugerencias de productos

Videos
SDS
Documentos

Documentos

Certificados
Ofertas especiales

Ofertas especiales

Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human GCP2 (aa 742-833) Control Fragment Recombinant Protein > 100 μL; Unlabeled

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado