missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human GCP2 (aa 742-833) Control Fragment Recombinant Protein Código de producto.: 30203258

Invitrogen™ Human GCP2 (aa 742-833) Control Fragment Recombinant Protein

Código de producto. 30203258
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30203258

Marca: Invitrogen™ RP97084

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58151 (PA5-58151. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The γ-Tubulin complex is composed of γ Tubulin and the γ-Tubulin complexassociated proteins GCP2, GCP3, GCP4, GCP5 and GCP6, all of which are essential components of microtubule organizing centers. γ-Tubulin complex components are localized to both the centrosome, where they are involved in microtubule nucleation, and to the cytoplasm, where they exist as soluble complexes that can be recruited to the centrosome as needed. Although the GCP proteins are related, they have distinct roles which contribute to the proper function of the γ-Tubulin complex. GCP2 (γ-Tubulin complex component 2), also known as TUBGCP2 or SPBC97 (spindle pole body protein Spc97 homolog) is a ubiquitously expressed 902 amino acid protein that localizes to the centrosome and is involved in microtubule nucleation.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q9BSJ2
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 10844
Nombre Human GCP2 (aa 742-833) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 1700022B05Rik; a disintegrin and metalloprotease domain 8; Adam8; Gamma-ring complex protein 103 kDa; gamma-tubulin complex component 2; GCP2; GCP-2; Grip103; h103p; hGCP2; hGrip103; hSpc97; SPBC97; Spc97p; spindle pole body protein Spc97 homolog; Tubgcp2; tubulin gamma complex associated protein 2; tubulin, gamma complex associated protein 2
Nombre común GCP2
Símbolo de gen TUBGCP2
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia PELLKVFSKLMSVCVMFTNCMQKFTQSMKLDGELGGQTLEHSTVLGLPAGAEERARKELARKHLAEHADTVQLVSGFEATINKFDKNFSAHL
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human GCP2 (aa 742-833) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado