Learn More
Invitrogen™ Human GCP2 (aa 742-833) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP97084
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (75%), Rat (75%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58151 (PA5-58151. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The γ-Tubulin complex is composed of γ Tubulin and the γ-Tubulin complexassociated proteins GCP2, GCP3, GCP4, GCP5 and GCP6, all of which are essential components of microtubule organizing centers. γ-Tubulin complex components are localized to both the centrosome, where they are involved in microtubule nucleation, and to the cytoplasm, where they exist as soluble complexes that can be recruited to the centrosome as needed. Although the GCP proteins are related, they have distinct roles which contribute to the proper function of the γ-Tubulin complex. GCP2 (γ-Tubulin complex component 2), also known as TUBGCP2 or SPBC97 (spindle pole body protein Spc97 homolog) is a ubiquitously expressed 902 amino acid protein that localizes to the centrosome and is involved in microtubule nucleation.
Especificaciones
Q9BSJ2 | |
Blocking Assay, Control | |
10844 | |
100 μL | |
1700022B05Rik; a disintegrin and metalloprotease domain 8; Adam8; Gamma-ring complex protein 103 kDa; gamma-tubulin complex component 2; GCP2; GCP-2; Grip103; h103p; hGCP2; hGrip103; hSpc97; SPBC97; Spc97p; spindle pole body protein Spc97 homolog; Tubgcp2; tubulin gamma complex associated protein 2; tubulin, gamma complex associated protein 2 | |
TUBGCP2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human GCP2 (aa 742-833) Control Fragment | |
RUO | |
GCP2 | |
Unconjugated | |
Recombinant | |
PELLKVFSKLMSVCVMFTNCMQKFTQSMKLDGELGGQTLEHSTVLGLPAGAEERARKELARKHLAEHADTVQLVSGFEATINKFDKNFSAHL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.