Learn More
Abnova™ Human GBE1 Partial ORF (NP_000149, 605 a.a. - 702 a.a.) Recombinant Protein with GST-tag at N-terminal
Descripción
The protein encoded by this gene is a glycogen branching enzyme that catalyzes the transfer of alpha-1,4-linked glucosyl units from the outer end of a glycogen chain to an alpha-1,6 position on the same or a neighboring glycogen chain. Branching of the chains is essential to increase the solubility of the glycogen molecule and, consequently, in reducing the osmotic pressure within cells. Highest level of this enzyme are found in liver and muscle. Mutations in this gene are associated with glycogen storage disease IV (also known as Andersen's disease). [provided by RefSeq]
Especificaciones
Especificaciones
| Número de acceso | NP_000149 |
| Para utilizar con (aplicación) | Antibody Production, ELISA, Protein Array, Western Blot |
| Formulación | 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
| ID de gen (Entrez) | 2632 |
| Peso molecular | 36.52kDa |
| Nombre | GBE1 (Human) Recombinant Protein (Q01) |
| Pruebas de control de calidad | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Cantidad | 10 ug |
| Inmunógeno | SEKHEGNKIIAFERAGLLFIFNFHPSKSYTDYRVGTALPGKFKIVLDSDAAEYGGHQRLDHSTDFFSEAFEHNGRPYSLLVYIPSRVALILQNVDLPN |
| Requisitos de almacenamiento | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Mostrar más |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.