Learn More
Invitrogen™ Human GADD45GIP1 (aa 84-117) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP103584
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (74%), Rat (74%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibodies, PA5-111409 (PA5-111409, PA5-64199 (PA5-64199. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Inhibitor of nuclear factor kappa-B kinase subunit beta (IKK beta) is a serine kinase that plays an essential role in the NF-kaapa-B signaling pathway which is activated by mulitple stimuli such as inflammatory cytokines, bacterial, or viral products, DNA damages, or other cellular stresses. IKK beta acts as part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on 2 critical serine residues. These modifications allow polyubiquitination of the inhibitors and subsequent degradation by the proteasome. In turn, free NF-kappa-B is translocated into the nucleus and activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. Mutations affecting the IKK beta gene can result in Immunodeficiency 15 (IMD15).
Especificaciones
Q8TAE8 | |
Blocking Assay, Control | |
90480 | |
100 μL | |
2310040G17Rik; 39 S ribosomal protein L59, mitochondrial; AI425883; CKBBP2; CKbetaBP2; CKII beta binding protein 2; CKII beta-associating protein; CR6 interacting factor 1; CR6-interacting factor 1; CRIF1; GADD45G interacting protein 1; GADD45GIP1; growth arrest- and DNA damage-inducible GADD45G-interacting protein; Growth arrest and DNA damage-inducible proteins-interacting protein 1; growth arrest and DNA-damage-inducible proteins-interacting protein 1; growth arrest and DNA-damage-inducible, gamma interacting protein 1; Mitochondrial large ribosomal subunit protein mL64; Mrpl59; MRP-L59; p53-responsive gene 6 protein; papillomavirus L2 interacting nuclear protein 1; Papillomavirus L2-interacting nuclear protein 1; PLINP; PLINP1; PLINP-1; PRG6 | |
Gadd45gip1 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human GADD45GIP1 (aa 84-117) Control Fragment | |
RUO | |
GADD45GIP1 | |
Unconjugated | |
Recombinant | |
ELEAEEREWYPSLATMQESLRVKQLAEEQKRRER | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.