Learn More
Invitrogen™ Human GABRG3 (aa 17-59) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP101533
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-111385 (PA5-111385. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
GABRG3 is a family of proteins involved in the GABAergic neurotransmission of the mammalian central nervous system. GABRG3 is a member of the GABA-A receptor gene family of heteromeric pentameric ligand-gated ion channels through which GABA, the major inhibitory neurotransmitter in the mammalian brain, acts. GABA-A receptors are the site of action of a number of important pharmacologic agents including barbiturates, benzodiazepines, and ethanol (summary by Whiting et al., 1999). For additional general information about the GABA-A receptor gene family, see GABRA1 (MIM 137160).
Especificaciones
Q99928 | |
Blocking Assay, Control | |
2567 | |
100 μL | |
B230362M20Rik; CAE2; ECA2; GABA(A) receptor subunit gamma-3; GABA(G) receptor; GABA(G) receptor, gamma 3; GABA-alpha receptor gamma-3 subunit; GABRG3; Gabrg-3; gamma-aminobutyric acid; gamma-aminobutyric acid (GABA) A receptor, gamma 3; gamma-aminobutyric acid (GABA) A receptor, subunit gamma 3; gamma-aminobutyric acid (GABA-A) receptor, subunit gamma 3; gamma-aminobutyric acid A receptor, gamma 3; gamma-aminobutyric acid receptor subunit gamma-3; gamma-aminobutyric acid type A receptor gamma3 subunit; GEFSP3 | |
GABRG3 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human GABRG3 (aa 17-59) Control Fragment | |
RUO | |
GABRG3 | |
Unconjugated | |
Recombinant | |
ARSRKVEEDEYEDSSSNQKWVLAPKSQDTDVTLILNKLLREYD | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.