missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human FLII (aa 776-904) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP89498
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82369 (PA5-82369. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Mahogunin (MGRN1) is a C3HC4 RING-containing protein with E3 ubiquitin ligase activity in vitro.
Especificaciones
| Q13045 | |
| Blocking Assay, Control | |
| 2314 | |
| 100 μL | |
| 3632430F08Rik; FLI; Fli1; flightless I actin binding protein; flightless I homolog; flightless I homolog (Drosophila); Flii; FLII actin remodeling protein; FLII, actin remodeling protein; Fliih; FLIL; Protein flightless-1 homolog | |
| FLII | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human FLII (aa 776-904) Control Fragment | |
| RUO | |
| FLII | |
| Unconjugated | |
| Recombinant | |
| YILDCWSDVFIWLGRKSPRLVRAAALKLGQELCGMLHRPRHATVSRSLEGTEAQVFKAKFKNWDDVLTVDYTRNAEAVLQSPGLSGKVKRDAEKKDQMKADLTALFLPRQPPMSLAEAEQLMEEWNEDL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human FLII (aa 776-904) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido