Learn More
Invitrogen™ Human FICD (aa 51-199) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP90613
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54396 (PA5-54396. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Protein that can both mediate the addition of adenosine 5'-monophosphate (AMP) to specific residues of target proteins (AMPylation), and the removal of the same modification from target proteins (de-AMPylation), depending on the context. The side chain of Glu-231 determines which of the two opposing activities (AMPylase or de-AMPylase) will take place. Acts as a key regulator of the ERN1/IRE1-mediated unfolded protein response (UPR) by mediating AMPylation or de-AMPylation of HSPA5/BiP (PubMed:25601083). In unstressed cells, acts as an adenylyltransferase by mediating AMPylation of HSPA5/BiP at 'Thr-518', thereby inactivating it. In response to endoplasmic reticulum stress, acts as a phosphodiesterase by mediating removal of ATP (de-AMPylation) from HSPA5/BiP at 'Thr-518', leading to restore HSPA5/BiP activity. Although it is able to AMPylate RhoA, Rac and Cdc42 Rho GTPases in vitro, Rho GTPases do not constitute physiological substrates (PubMed:19362538, PubMed:25601083). [UniProt]
Especificaciones
Q9BVA6 | |
Blocking Assay, Control | |
11153 | |
100 μL | |
adenosine monophosphate-protein transferase FICD; AMPylator FICD; D5Ertd40e; De-AMPylase FICD; FIC domain containing; FIC domain protein adenylyltransferase; FIC domain-containing protein; fic S-phase protein cell division homolog; FICD; HIP13; HIP-13; huntingtin interacting protein 13; huntingtin interacting protein E; huntingtin interactor protein E; huntingtin yeast partner E; Huntingtin-interacting protein 13; huntingtin-interacting protein E; Hype; MGC5623; Protein adenylyltransferase FICD; protein adenylyltransferase FICD; adenosine monophosphate-protein transferase FICD; UNQ3041; UNQ3041/PRO9857 | |
Ficd | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human FICD (aa 51-199) Control Fragment | |
RUO | |
FICD | |
Unconjugated | |
Recombinant | |
CLAVLKGLYLLRSKPDRAQHAATKCTSPSTELSITSRGATLLVAKTKASPAGKLEARAALNQALEMKRQGKREKAQKLFMHALKMDPDFVDALTEFGIFSEEDKDIIQADYLYTRALTISPYHEKALVNRDRTLPLVEEIDQRYFSIID | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.