Learn More
Invitrogen™ Human FGFR4 (aa 26-93) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP95218
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
FGFR4 is a member of the FGFR family of receptor tyrosine kinases. This family is known to regulate a host of cellular functions including angiogenesis, mitogenesis, osteogenesis, myogenesis, carcinogenesis, cellular differentiation, and tissue repair after injury. The FGFR family has also been implicated in a number of diseases including cancer, rheumatoid arthritis, and diabetic retinopathy. FGFR4 is required for normal down-regulation of the expression of CYP7A1, the rate-limiting enzyme in bile acid synthesis, in response to FGF19. FGFR4 plays a role in postnatal lung development and may be involved in the development of skeletal muscle cell lineages.
Especificaciones
P22455 | |
Blocking Assay, Control | |
2264 | |
100 μL | |
CD334; CTLA-2-beta protein; FGF Receptor; FGF Receptor 4; FGFR; Fgfr4; FGFR-4; Fibroblast growth factor receptor 4; fibroblast growth factor receptor 4 16 minus form; hydroxyaryl-protein kinase; JTK2; MGC20292; Mpk-11; protein-tyrosine kinase; protein-tyrosine kinase receptor MPK-11; TKF; tyrosine kinase related to fibroblast growth factor receptor; tyrosylprotein kinase | |
Fgfr4 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human FGFR4 (aa 26-93) Control Fragment | |
RUO | |
FGFR4 | |
Unconjugated | |
Recombinant | |
EEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGRLEIASFLP | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.