Learn More
Invitrogen™ Human ESCO2 (aa 4-86) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP106486
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65813 (PA5-65813. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a protein that may have acetyltransferase activity and may be required for the establishment of sister chromatid cohesion during the S phase of mitosis. Mutations in this gene have been associated with Roberts syndrome.
Especificaciones
Q56NI9 | |
Blocking Assay, Control | |
157570 | |
100 μL | |
2410004I17Rik; D030072L07Rik; ECO1 homolog 2; EFO2; Esco2; Establishment factor-like protein 2; Establishment of cohesion 1 homolog 2; establishment of cohesion 1 homolog 2 (S. cerevisiae); establishment of sister chromatid cohesion N-acetyltransferase 2; N-acetyltransferase ESCO2; RBS | |
ESCO2 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human ESCO2 (aa 4-86) Control Fragment | |
RUO | |
ESCO2 | |
Unconjugated | |
Recombinant | |
LTPRKRKQDSLKCDSLLHFTENLFPSPNKKHCFYQNSDKNEENLHCSQQEHFVLSALKTTEINRLPSANQGSPFKSALSTVSF | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.