missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human EPN1 Partial ORF (NP_037465.2, 346 a.a. - 428 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00029924-Q01.10ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
EPN1 is an endocytic accessory protein that interacts with EPS15 (MIM 600051), the alpha subunit of the clathrin adaptor AP2 (AP2A1; MIM 601026), and clathrin (see MIM 118960), as well as with other accessory proteins for the endocytosis of clathrin-coated vesicles.[supplied by OMIM]
Sequence: PAPAFSDPWGGSPAKPSTNGTTAGGFDTEPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRGSLAEAVGSEspecificaciones
| NP_037465.2 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 34.87kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| PAPAFSDPWGGSPAKPSTNGTTAGGFDTEPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRGSLAEAVGS | |
| RUO | |
| EPN1 | |
| Recombinant | |
| wheat germ expression system |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 29924 | |
| EPN1 (Human) Recombinant Protein (Q01) | |
| 10 μg | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| EPN1 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ Human EPN1 Partial ORF (NP_037465.2, 346 a.a. - 428 a.a.) Recombinant Protein with GST-tag at N-terminal > 10μg
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido