Learn More
Abnova™ Human EPN1 Partial ORF (NP_037465.2, 346 a.a. - 428 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00029924-Q01.10ug
Descripción
EPN1 is an endocytic accessory protein that interacts with EPS15 (MIM 600051), the alpha subunit of the clathrin adaptor AP2 (AP2A1; MIM 601026), and clathrin (see MIM 118960), as well as with other accessory proteins for the endocytosis of clathrin-coated vesicles.[supplied by OMIM]
Sequence: PAPAFSDPWGGSPAKPSTNGTTAGGFDTEPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRGSLAEAVGSEspecificaciones
NP_037465.2 | |
50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
34.87kDa | |
12.5% SDS-PAGE Stained with Coomassie Blue. | |
PAPAFSDPWGGSPAKPSTNGTTAGGFDTEPDEFSDFDRLRTALPTSGSSAGELELLAGEVPARSPGAFDMSGVRGSLAEAVGS | |
RUO | |
EPN1 | |
Recombinant | |
wheat germ expression system |
Antibody Production, ELISA, Protein Array, Western Blot | |
29924 | |
EPN1 (Human) Recombinant Protein (Q01) | |
10 μg | |
Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
EPN1 | |
Wheat Germ (in vitro) | |
GST | |
Liquid |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.