missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Abnova™ Human ENTPD4 Partial ORF (NP_004892.1, 371 a.a. - 469 a.a.) Recombinant Protein with GST-tag at N-terminal
Used for AP, Array, ELISA, WB-Re
Marca: Abnova™ H00009583-Q01.25ug
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Sequence: LDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILREspecificaciones
| NP_004892.1 | |
| 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. | |
| 36.63kDa | |
| 12.5% SDS-PAGE Stained with Coomassie Blue. | |
| LDIKDEIQQNGQTIYLRGTGDFDLCRETIQPFMNKTNETQTSLNGVYQPPIHFQNSEFYGFSEFYYCTEDVLRMGGDYNAAKFTKAAKDYCATKWSILR | |
| RUO | |
| ENTPD4 | |
| Wheat Germ (in vitro) | |
| GST | |
| Liquid |
| Antibody Production, ELISA, Protein Array, Western Blot | |
| 9583 | |
| ENTPD4 (Human) Recombinant Protein (Q01) | |
| 25 μg | |
| Store at -80°C. Aliquot to avoid repeated freezing and thawing. | |
| KIAA0392/LALP70/LAP70/LYSAL1/NTPDase-4/UDPase | |
| ENTPD4 | |
| Recombinant | |
| wheat germ expression system |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Abnova™ Human ENTPD4 Partial ORF (NP_004892.1, 371 a.a. - 469 a.a.) Recombinant Protein with GST-tag at N-terminal > 25μg
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido