Learn More
Invitrogen™ Human EFR3A (aa 440-524) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP93789
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54694 (PA5-54694. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Especificaciones
Q14156 | |
Blocking Assay, Control | |
23167 | |
100 μL | |
A130089M23Rik; BB071175; C76891; C920006C10Rik; D030063F01Rik; EFR3 homolog A; EFR3 homolog A (S. cerevisiae); Efr3a; KIAA0143; mKIAA0143; Protein EFR3 homolog A; Protein EFR3-like; RGD1305976 | |
EFR3A | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human EFR3A (aa 440-524) Control Fragment | |
RUO | |
EFR3A | |
Unconjugated | |
Recombinant | |
LLMVTSGYKAKTIVTALPGSFLDPLLSPSLMEDYELRQLVLEVMHNLMDRHDNRAKLRGIRIIPDVADLKIKREKICRQDTSFMK | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.