missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human EDEM3 (aa 823-931) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP105774
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (72%), Rat (72%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-65009 (PA5-65009. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Involved in endoplasmic reticulum-associated degradation (ERAD). Accelerates the glycoprotein ERAD by proteasomes, by catalyzing mannose trimming from Man8GlcNAc2 to Man7GlcNAc2 in the N-glycans. Seems to have alpha 1,2-mannosidase activity.
Especificaciones
| Q9BZQ6 | |
| Blocking Assay, Control | |
| 80267 | |
| 100 μL | |
| 2310050N11Rik; Alpha-1,2-mannosidase EDEM3; C1orf22; EDEM3; ER degradation enhancer, mannosidase alpha-like 3; ER degradation enhancing alpha-mannosidase like protein 3; ER degradation-enhancing alpha-mannosidase-like 3; ER degradation-enhancing alpha-mannosidase-like protein 3; ER degradation-enhancing -mannosidase-like protein 3; RGD1561496 | |
| EDEM3 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human EDEM3 (aa 823-931) Control Fragment | |
| RUO | |
| EDEM3 | |
| Unconjugated | |
| Recombinant | |
| SSQEVDLVDQESSEENSLNSHPESLSLADMDNAASISPSEQTSNPTENHETTNLNGECTDLDNQLQEQSETEEDSNPNVSWGKKVQPIDSILADWNEDIEAFEMMEKDE | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human EDEM3 (aa 823-931) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido