missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human ECM2 (aa 281-366) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP92900
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (69%), Rat (69%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57239 (PA5-57239. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
ECM2 encodes extracellular matrix protein 2, so named because it shares extensive similarity with known extracelluar matrix proteins. Three transcript variants encoding different isoforms have been found for this gene.
Especificaciones
| O94769 | |
| Blocking Assay, Control | |
| 1842 | |
| 100 μL | |
| 9030618O22Rik; BC065151; ECM2; Extracellular matrix protein 2; extracellular matrix protein 2, female organ and adipocyte specific; extracellular matrix protein 2-like; LOC100361383; Matrix glycoprotein SC1/ECM2; Tenonectin | |
| ECM2 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human ECM2 (aa 281-366) Control Fragment | |
| RUO | |
| ECM2 | |
| Unconjugated | |
| Recombinant | |
| EGEEDEEDEEDPVRGDMFRMPSRSPLPAPPRGTLRLPSGCSLSYRTISCINAMLTQIPPLTAPQITSLELTGNSIASIPDEAFNGL | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human ECM2 (aa 281-366) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido