Learn More
Invitrogen™ Human DUSP8 (aa 269-348) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP91582
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82712 (PA5-82712. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates SAPK/JNK and p38, is expressed predominantly in the adult brain, heart, and skeletal muscle, is localized in the cytoplasm, and is induced by nerve growth factor and insulin. An intronless pseudogene for DUSP8 is present on chromosome 10q11.2.
Especificaciones
Q13202 | |
Blocking Assay, Control | |
1850 | |
100 μL | |
5530400B01Rik; AI593498; C11orf81; dual specificity phosphatase 8; dual specificity protein phosphatase 8; Dual specificity protein phosphatase hVH-5; Dusp8; FLJ42476; FLJ42958; H1 phosphatase, vaccinia virus homolog; Hb5; HVH-5; HVH8; M3/6; neuronal tyrosine threonine phosphatase 1; neuronal tyrosine/threonine phosphatase 1; Nttp1; OTTHUMP00000164487; serine/threonine specific protein phosphatase; VH5 | |
DUSP8 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human DUSP8 (aa 269-348) Control Fragment | |
RUO | |
DUSP8 | |
Unconjugated | |
Recombinant | |
SDDAYRFVKDRRPSISPNFNFLGQLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAR | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.