missing translation for 'onlineSavingsMsg'
Learn More

Invitrogen™ Human DUSP8 (aa 269-348) Control Fragment Recombinant Protein

Código de producto. 30205844
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones
Este artículo no se puede devolver. Vea la política de devoluciones

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (84%), Rat (84%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82712 (PA5-82712. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which is associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates SAPK/JNK and p38, is expressed predominantly in the adult brain, heart, and skeletal muscle, is localized in the cytoplasm, and is induced by nerve growth factor and insulin. An intronless pseudogene for DUSP8 is present on chromosome 10q11.2.
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q13202
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 1850
Nombre Human DUSP8 (aa 269-348) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen 5530400B01Rik; AI593498; C11orf81; dual specificity phosphatase 8; dual specificity protein phosphatase 8; Dual specificity protein phosphatase hVH-5; Dusp8; FLJ42476; FLJ42958; H1 phosphatase, vaccinia virus homolog; Hb5; HVH-5; HVH8; M3/6; neuronal tyrosine threonine phosphatase 1; neuronal tyrosine/threonine phosphatase 1; Nttp1; OTTHUMP00000164487; serine/threonine specific protein phosphatase; VH5
Nombre común DUSP8
Símbolo de gen DUSP8
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia SDDAYRFVKDRRPSISPNFNFLGQLLEYERSLKLLAALQGDPGTPSGTPEPPPSPAAGAPLPRLPPPTSESAATGNAAAR
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human DUSP8 (aa 269-348) Control Fragment Recombinant Protein >

Al hacer clic en Enviar, acepta que Fisher Scientific se ponga en contacto con usted en relación con los comentarios que ha proporcionado en este formulario. No compartiremos su información para ningún otro fin. Toda la información de contacto proporcionada se mantendrá de acuerdo con nuestra Política de Privacidad. Política de privacidad.

Gracias por ayudarnos a mejorar nuestra web. Su comentario ha sido enviado