missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human DSC1 (aa 558-681) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP90225
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (73%), Rat (73%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-53004 (PA5-53004. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
The desmosomal cadherin desmocollin DSC1 is expressed in upper epidermis where strong adhesion is required. DSC1 is a type I membrane protein (4) required for strong adhesion and barrier maintenance in epidermis and contributes to epidermal differentiation.The DSC1 gene comprises 17 exons spanning approximately 33 kb on 18q12.1.
Especificaciones
| Q08554 | |
| Blocking Assay, Control | |
| 1823 | |
| 100 μL | |
| 1110020A10Rik; AI507491; Cadherin family member 1; CDHF1; desmocollin 1; Desmocollin1; desmocollin-1; Desmosomal glycoprotein 2/3; DG2/DG3; DSC1; Dsc1a; Dsc1b | |
| DSC1 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human DSC1 (aa 558-681) Control Fragment | |
| RUO | |
| DSC1 | |
| Unconjugated | |
| Recombinant | |
| SCTGTLVVHLDDYNDHAPQIDKEVTICQNNEDFAVLKPVDPDGPENGPPFQFFLDNSASKNWNIEEKDGKTAILRQRQNLDYNYYSVPIQIKDRHGLVATHMLTVRVCDCSTPSECRMKDKSTR | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human DSC1 (aa 558-681) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido