missing translation for 'onlineSavingsMsg'
Learn More
Abnova™ Human DOT1L Partial ORF (NP_115871, 3 a.a. - 108 a.a.) Recombinant Protein with GST-tag at N-terminal Código de producto.: 16170757
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. Abnova™ Human DOT1L Partial ORF (NP_115871, 3 a.a. - 108 a.a.) Recombinant Protein with GST-tag at N-terminal

Abnova™ Human DOT1L Partial ORF (NP_115871, 3 a.a. - 108 a.a.) Recombinant Protein with GST-tag at N-terminal

Código de producto. 16170757
10 μg, 10 microgramos
Click to view available options
Cantidad:
10 μg
25 μg
Tamaño de la unidad:
10 microgramos
25 microgramos
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 16170757

Marca: Abnova™ H00084444Q01.10ug

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo actualmente no está disponible o ha sido discontinuado.
Ver la página del producto para posibles alternativas
 Ver productos alternativos

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Used for AP, Array, ELISA, WB-Re

Sequence: EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR

Specifications

Número de acceso NP_115871
Para utilizar con (aplicación) Antibody Production, ELISA, Protein Array, Western Blot
Formulación 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
ID de gen (Entrez) 84444
Peso molecular 37.4kDa
Nombre DOT1L (Human) Recombinant Protein (Q01)
Pruebas de control de calidad 12.5% SDS-PAGE Stained with Coomassie Blue.
Cantidad 10 μg
Inmunógeno EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR
Requisitos de almacenamiento Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Estado normativo RUO
Alias de gen DKFZp586P1823/DOT1/KIAA1814/KMT4
Nombre común DOT1L
Símbolo de gen DOT1L
Especie Wheat Germ (in vitro)
Recombinante Recombinant
Etiqueta de proteína GST
Sistema de expresión wheat germ expression system
Formulario Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title
Abnova™ Human DOT1L Partial ORF (NP_115871, 3 a.a. - 108 a.a.) Recombinant Protein with GST-tag at N-terminal >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.