Learn More
Invitrogen™ Human DOK4 (aa 40-98) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP101658
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-63190 (PA5-63190. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK4 functions in RET-mediated neurite outgrowth and plays a positive role in activation of the MAP kinase pathway. Putative link with downstream effectors of RET in neuronal differentiation. May be involved in the regulation of the immune response induced by T-cells. [UniProt]
Especificaciones
Q8TEW6 | |
Blocking Assay, Control | |
55715 | |
100 μL | |
docking protein 4; Dok4; Downstream of tyrosine kinase 4; insulin receptor substrate 5; IRS5; IRS-5 | |
DOK4 | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human DOK4 (aa 40-98) Control Fragment | |
RUO | |
DOK4 | |
Unconjugated | |
Recombinant | |
QRLEKYPDEKSVCLRGCPKVTEISNVKCVTRLPKETKRQAVAIIFTDDSARTFTCDSEL | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.