missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human DIP2C (aa 38-87) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP105126
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-66248 (PA5-66248. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the disco-interacting protein homolog 2 family. The protein shares strong similarity with a Drosophila protein which interacts with the transcription factor disco and is expressed in the nervous system.
Especificaciones
| Q9Y2E4 | |
| Blocking Assay, Control | |
| 22982 | |
| 100 μL | |
| 2900024P20Rik; 9630044M06; DIP2 disco-interacting protein 2 homolog C; DIP2 disco-interacting protein 2 homolog C (Drosophila); DIP2 homolog C; DIP2C; disco interacting protein 2 homolog C; disco-interacting protein 2 homolog C; KIAA0934; mKIAA0934; RGD1560155 | |
| DIP2C | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human DIP2C (aa 38-87) Control Fragment | |
| RUO | |
| DIP2C | |
| Unconjugated | |
| Recombinant | |
| KKRSKLIGAYLPQPPRVDQALPQERRAPVTPSSASRYHRRRSSGSRDERY | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human DIP2C (aa 38-87) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido