missing translation for 'onlineSavingsMsg'
Learn More
Invitrogen™ Human DESI1 (aa 27-82) Control Fragment Recombinant Protein Código de producto.: 30200859
  1. Home
  2. Products
  3. Proteínas recombinantes
  4. 30200859

Invitrogen™ Human DESI1 (aa 27-82) Control Fragment Recombinant Protein

Código de producto. 30200859
100 μL, 100 microlitros
Click to view available options
Cantidad:
100 μL
Tamaño de la unidad:
100 microlitros
Este artículo no se puede devolver. Vea la política de devoluciones

Código de producto. 30200859

Marca: Invitrogen™ RP100920

Por favor, para comprar este producto. ¿No tiene usuario web? Regístrese hoy mismo.

Este artículo no se puede devolver. Vea la política de devoluciones

Descripción

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (95%), Rat (95%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62786 (PA5-62786. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Protease which deconjugates SUMO1, SUMO2 and SUMO3 from some substrate proteins. Has isopeptidase but not SUMO-processing activity. Desumoylates ZBTB46. Collaborates with UBQLN4 in the export of ubiquitinated proteins from the nucleus to the cytoplasm (PubMed:29666234). [UniProt]
TRUSTED_SUSTAINABILITY

Especificaciones

Número de acceso Q6ICB0
Concentración ≥5.0 mg/mL
Para utilizar con (aplicación) Blocking Assay, Control
Formulación 1 M urea, PBS with no preservative; pH 7.4
ID de gen (Entrez) 27351
Nombre Human DESI1 (aa 27-82) Control Fragment
Cantidad 100 μL
Estado normativo RUO
Alias de gen D15Wsu75e; DESI1; DeSI-1; DESI2; desumoylating isopeptidase 1; desumoylating isopeptidase 2; DJ347H13.4; FAM152B; family with sequence similarity 152, member B; Polyubiquitinated substrate transporter; POST; PPPDE peptidase domain containing 2; PPPDE peptidase domain-containing protein 2; PPPDE2
Nombre común DESI1
Símbolo de gen DESI1
Conjugado Unconjugated
Especie Human
Recombinante Recombinant
Etiqueta de proteína His-ABP-tag
Secuencia IMLGKQLEGIWHTSIVVHKDEFFFGSGGISSCPPGGTLLGPPDSVVDVGSTEVTEE
Contenido y almacenamiento -20°C, Avoid Freeze/Thaw Cycles
Sistema de expresión E. coli
Formulario Liquid
Grado de pureza o calidad >80% by SDS-PAGE and Coomassie blue staining
Mostrar más Mostrar menos
Corrección del contenido de un producto

Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.

Título del producto
Invitrogen™ Human DESI1 (aa 27-82) Control Fragment Recombinant Protein >

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Thank You! Your feedback has been submitted. Fisher Scientific is always working to improve our content for you. We appreciate your feedback.