missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Invitrogen™ Human DDX6 (aa 124-255) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP92558
Este artículo no se puede devolver.
Vea la política de devoluciones
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110921 (PA5-110921. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a member of the DEAD box protein family. The protein is an RNA helicase found in P-bodies and stress granules, and functions in translation suppression and mRNA degradation. It is required for microRNA-induced gene silencing.
Especificaciones
| P26196 | |
| Blocking Assay, Control | |
| 1656 | |
| 100 μL | |
| 1110001P04Rik; ATP-dependent RNA helicase p54; DD x 6; D-E-A-D (aspartate-glutamate-alanine-aspartate) box polypeptide 6; DEAD (aspartate-glutamate-alanine-aspartate) box polypeptide 6; DEAD (Asp-Glu-Ala-Asp) box helicase 6; DEAD (Asp-Glu-Ala-Asp) box polypeptide 6; DEAD box protein 6; DEAD box-6; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6; DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 6 (RNA helicase, 54 kD); DEAD-box helicase 6; DEAD-box protein 6; E230023J21Rik; HLR2; mRCK/P54; Oncogene RCK; oncogene RCK homolog; p54; probable ATP-dependent RNA helicase DD x 6; RCK; RGD1564560 | |
| DDX6 | |
| Human | |
| His-ABP-tag | |
| -20°C, Avoid Freeze/Thaw Cycles | |
| Liquid |
| ≥5.0 mg/mL | |
| 1 M urea, PBS with no preservative; pH 7.4 | |
| Human DDX6 (aa 124-255) Control Fragment | |
| RUO | |
| DDX6 | |
| Unconjugated | |
| Recombinant | |
| EESIPIALSGRDILARAKNGTGKSGAYLIPLLERLDLKKDNIQAMVIVPTRELALQVSQICIQVSKHMGGAKVMATTGGTNLRDDIMRLDDTVHVVIATPGRILDLIKKGVAKVDHVQMIVLDEADKLLSQD | |
| E. coli | |
| >80% by SDS-PAGE and Coomassie blue staining |
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto
Invitrogen™ Human DDX6 (aa 124-255) Control Fragment Recombinant Protein > 100 μL; Unlabeled
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido