Learn More
Invitrogen™ Human CTNS (aa 73-122) Control Fragment Recombinant Protein
Recombinant Protein
Marca: Invitrogen™ RP110244
Descripción
Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-145081 (PA5-145081. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
This gene encodes a seven-transmembrane domain protein that functions to transport cystine out of lysosomes. Its activity is driven by the H+ electrochemical gradient of the lysosomal membrane. Mutations in this gene cause cystinosis, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants.
Especificaciones
O60931 | |
Blocking Assay, Control | |
1497 | |
100 μL | |
AI195360; AW049661; CTNS; CTNS-LSB; Cystinosin; cystinosin, lysosomal cystine transporter; cystinosis nephropathic; cystinosis, nephropathic; PQLC4 | |
Ctns | |
Human | |
His-ABP-tag | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
≥5.0 mg/mL | |
1 M urea, PBS with no preservative; pH 7.4 | |
Human CTNS (aa 73-122) Control Fragment | |
RUO | |
CTNS | |
Unconjugated | |
Recombinant | |
PDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSA | |
E. coli | |
>80% by SDS-PAGE and Coomassie blue staining |
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.